PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DS_5BAD8947E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 531aa    MW: 58689.1 Da    PI: 7.6894
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DS_5BAD8947E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-17116163148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            +g W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Traes_1DS_5BAD8947E.1 116 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 163
                            678*******************************************97 PP

2Myb_DNA-binding43.57.2e-14169212146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++ ++E++l+v++++ lG++ W+ Ia+ m+ gRt++++k+ w++
  Traes_1DS_5BAD8947E.1 169 RGAFAQDEEDLIVELHAVLGNR-WSQIAAQMP-GRTDNEIKNLWNS 212
                            79999*****************.*********.*********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-27108166IPR009057Homeodomain-like
PROSITE profilePS5129424.791111167IPR017930Myb domain
SuperFamilySSF466898.03E-29114210IPR009057Homeodomain-like
SMARTSM007175.0E-12115165IPR001005SANT/Myb domain
PfamPF002494.5E-15116163IPR001005SANT/Myb domain
CDDcd001674.26E-11119163No hitNo description
Gene3DG3DSA:1.10.10.608.4E-24167218IPR009057Homeodomain-like
SMARTSM007171.7E-11168216IPR001005SANT/Myb domain
PROSITE profilePS5129419.224168218IPR017930Myb domain
PfamPF002494.4E-12169212IPR001005SANT/Myb domain
CDDcd001673.77E-8174214No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
RGGCPAKKRR GVPPNLSLLS TEISYLQPYT LLLFLLNSAL SNHFPIYKSL YPLHFTPLQP  60
WIPEEALRYQ RRLLLCVIAS CVSSANPSGL RISSSQALHC TEMGRHSCCY KQKLRKGLWS  120
PEEDEKLMNH ITKHGHGCWS SVPKLAGLQR CGKSCRLRWI NYLRPDLKRG AFAQDEEDLI  180
VELHAVLGNR WSQIAAQMPG RTDNEIKNLW NSSLKKKLRQ KGIDPNTHKP LTEADRSGAA  240
PTISTERTSG SSDVNPSSAG ALGNFGHLLS ETAQSSMLLP VYDKKRPETP SLARPKVPAK  300
ELFLDQLTAG HESPSSCRSS GPTLYFPFQQ QLGYSNECGS GDGANMNSLW FNQNDFSCNT  360
ISTVMPTVSP SALSTPMGLN LPPDNHRHGG TGIGSAPFYW DGVNPSSSGS TGSSGSNSMG  420
FEPQSTNSIL ENSVFPWTDI GVGQEKDTRV QLVEELKWPD LLHGTFAEAT TAMQNQSQSL  480
YDDVIKAESQ FNMEGICASW FQNQQPQQQL QAASDMYDKD LQRMPLSFEH I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-281142185108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213219LKKKLRQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8573100.0JN857310.1 Triticum aestivum cultivar Shannong0431 MYB75 (MYB75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568972.10.0PREDICTED: transcription factor MYB46-like isoform X1
TrEMBLW5ALB70.0W5ALB7_WHEAT; Uncharacterized protein
STRINGMLOC_59663.60.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23103794
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.15e-78myb domain protein 61
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]